PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009785235.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 146aa    MW: 16109.4 Da    PI: 7.1916
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009785235.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.42.9e-161255245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    +i     r vtfskRr+g++KKA EL  +++a+va i+fs+tgk
  XP_009785235.1 12 QIMKAASRMVTFSKRRKGLFKKALELESMTGARVAAIVFSPTGK 55
                    56677889***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-20362IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.339357IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-20471IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-14525IPR002100Transcription factor, MADS-box
PfamPF003191.8E-191357IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-142540IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-144061IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MGTGKKKIEI KQIMKAASRM VTFSKRRKGL FKKALELESM TGARVAAIVF SPTGKPYISG  60
DVNSAIDRHF SSSIDPSSGS YDVSSGSSES RSSPLRNGLC NWLENIDVEE CENLNELLLL  120
KEQLEGTREK LACMEDSESF LAMFMS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009785235.11e-104PREDICTED: MADS-box transcription factor 23-like
RefseqXP_016458072.11e-104PREDICTED: MADS-box transcription factor 23-like
TrEMBLK4B0J43e-54K4B0J4_SOLLC; Uncharacterized protein
STRINGSolyc01g098070.1.19e-54(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23371757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72350.11e-17M-type_MADS family protein